SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1vg0A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1vg0A
Domain Number 1 Region: 4-445,557-609
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.15e-84
Family GDI-like N domain 0.0000000000000214
Further Details:      
 
Domain Number 2 Region: 445-556
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.2e-40
Family GDI-like 0.000000671
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1vg0A   PDB: 1vg0
Sequence length 650
Comment (A:)
Sequence
madnlpsdfdvivigtglpesiiaaacsrsgqrvlhvdsrsyyggnwasfsfsgllswlk
eyqenndvvtensmwqeqileneeaiplsskdktiqhvevfcyasqdlhkdveeagalqk
nhasvtsaqsaeaaeaaetsclptaveplsmgsceipaeqsqcpgpesspevndaeatgk
kensdakssteepsenvpkvqdntetpkknritysqiikegrrfnidlvskllysrglli
dlliksnvsryaefknitrilafregtveqvpcsradvfnskqltmvekrmlmkfltfcv
eyeehpdeyrayegttfseylktqkltpnlqyfvlhsiamtsettsctvdglkatkkflq
clgrygntpflfplygqgelpqcfcrmcavfggiyclrhsvqclvvdkesrkckavidqf
gqriiskhfiiedsylsentcsrvqyrqisravlitdgsvlrtdadqqvsiltvpaeepg
sfavrvielcsstmtcmkgtylvhltcmssktaredlervvqklftpyteieaeneqvek
prllwalyfnmrdssdisrdcyndlpsnvyvcsgpdsglgndnavkqaetlfqqicpned
fcpappnpedivldgdssqqevpessvtpetnsetpkestvlgnpeepse
Download sequence
Identical sequences 1vg0A 1vg0_A 1vg9_A 1vg9_C 1vg9_E 1vg9_G

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]