SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1vpwA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1vpwA
Domain Number 1 Region: 58-331
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.87e-119
Family L-arabinose binding protein-like 0.00000000297
Further Details:      
 
Domain Number 2 Region: 2-46
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 2.73e-22
Family GalR/LacI-like bacterial regulator 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1vpwA   PDB: 1vpw
Sequence length 340
Comment (A:)
Sequence
atikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarsmkvnhtks
igllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllv
mcseypepllamleeyrhipmvvmdwgeakadftdavidnafeggymagrylierghrei
gvipgplerntgagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqphrpt
avfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslgeta
fnmlldrivnkreepqsievhprlierrsvadgpfrdyrr
Download sequence
Identical sequences 1vpwA 1vpw_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]