SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1vqwA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1vqwA
Domain Number 1 Region: 6-239
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.96e-46
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000000198
Further Details:      
 
Domain Number 2 Region: 270-435
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.62e-16
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000000688
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1vqwA   PDB: 1vqw
Sequence length 457
Comment (A:)
Sequence
mslclptirkiaiigagpsglvtakallaekafdqvtlferrgspggvwnytstlsnklp
vpstnpilttepivgpaalpvypsplyrdlqtntpielmgycdqsfkpqtlqfphrhtiq
eyqriyaqpllpfiklatdvldiekkdgswvvtykgtkagspiskdifdavsicnghyev
pyipnikgldeyakavpgsvlhsslfrepelfvgesvlvvggassandlvrhltpvakhp
iyqsllgggdiqneslqqvpeitkfdpttreiylkggkvlsnidrviyctgylysvpfps
laklkspetkliddgshvhnvyqhifyipdptlafvglalhvvpfptsqaqaaflarvws
grlklpskeeqlkwqdelmfslsgannmyhsldypkdatyinklhdwckqatpvleeefp
spywgekersirenmwsirakffgieppkeghhhhhh
Download sequence
Identical sequences 1vqw_A 1vqw_B NYSGXRC-T1729 1vqwA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]