SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1wumA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1wumA
Domain Number 1 Region: 18-112
Classification Level Classification E-value
Superfamily Bromodomain 5.79e-46
Family Bromodomain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1wumA   PDB: 1wum
Sequence length 118
Comment (A:)
Sequence
gshmskeprdpdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlktms
erlknryyvskklfmadlqrvftnckeynppeseyykcanilekfffskikeaglidk
Download sequence
Identical sequences 1wumA 1jm4_B 1n72_A 1wug_A 1wum_A 1zs5_A 2rnw_A 2rnx_A cath|current|1jm4B00/715-832 cath|current|1n72A00/718-832 cath|current|1wugA00/715-832 cath|current|1wumA00/715-832 cath|current|1zs5A00/715-832 cath|current|2rnwA00/715-832 cath|current|2rnxA00/715-832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]