SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1wvnA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1wvnA
Domain Number 1 Region: 7-72
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.29e-24
Family Eukaryotic type KH-domain (KH-domain type I) 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1wvnA   PDB: 1wvn
Sequence length 82
Comment (A:)
Sequence
plgsqttheltipnnligciigrqganineirqmsgaqikianpvegssgrqvtitgsaa
sislaqylinarlssekgmgcs
Download sequence
Identical sequences 1wvn_A 1wvnA cath|current|1wvnA00/1-74

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]