SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1xanA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1xanA
Domain Number 1 Region: 349-461
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 5.78e-65
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000613
Further Details:      
 
Domain Number 2 Region: 4-60,87-340
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.68e-50
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1xanA   PDB: 1xan
Sequence length 461
Comment (A:)
Sequence
vasydylvigggsgglasarraaelgaraavveshklggtcvnvgcvpkkvmwntavhse
fmhdhadygfpscegkfnwrvikekrdayvsrlnaiyqnnltkshieiirghaaftsdpk
ptievsgkkytaphiliatggmpstphesqipgaslgitsdgffqleelpgrsvivgagy
iavemagilsalgsktslmirhdkvlrsfdsmistncteelenagvevlkfsqvkevkkt
lsglevsmvtavpgrlpvmtmipdvdcllwaigrvpntkdlslnklgiqtddkghiivde
fqntnvkgiyavgdvcgkalltpvaiaagrklahrlfeykedskldynniptvvfshppi
gtvgltedeaihkygienvktystsftpmyhavtkrktkcvmkmvcankeekvvgihmqg
lgcdemlqgfavavkmgatkadfdntvaihptsseelvtlr
Download sequence
Identical sequences 1k4q_A 1xan_A 1xanA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]