SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1xdiA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1xdiA
Domain Number 1 Region: 3-341
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.15e-44
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000000354
Further Details:      
 
Domain Number 2 Region: 350-467
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 5.73e-25
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000813
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1xdiA   PDB: 1xdi
Sequence length 499
Comment (A:)
Sequence
mvtrivilgggpagyeaalvaatshpettqvtvidcdgiggaavlddcvpsktfiastgl
rtelrraphlgfhidfddakislpqiharvktlaaaqsaditaqllsmgvqviagrgeli
dstpglarhrikataadgstseheadvvlvatgasprilpsaqpdgeriltwrqlydlda
lpdhlivvgsgvtgaefvdaytelgvpvtvvasqdhvlpyedadaalvleesfaergvrl
fknaraasvtrtgagvlvtmtdgrtvegshalmtigsvpntsglglervgiqlgrgnylt
vdrvsrtlatgiyaagdctgllplasvaamqgriamyhalgegvspirlrtvaatvftrp
eiaavgvpqsvidagsvaartimlplrtnarakmsemrhgfvkifcrrstgvviggvvva
piaselilpiavavqnritvnelaqtlavypslsgsiteaarrlmahddldctaaqdaae
qlalvphhlptsnhhhhhh
Download sequence
Identical sequences 1xdiA 1xdi_A 1xdi_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]