SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1xhcA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1xhcA
Domain Number 1 Region: 7-297
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.14e-44
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000149
Further Details:      
 
Domain Number 2 Region: 298-359
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 9.5e-29
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0000214
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1xhcA   PDB: 1xhc
Sequence length 367
Comment (A:)
Sequence
ahhhhhhgskvvivgngpggfelakqlsqtyevtvidkepvpyyskpmlshyiagfiprn
rlfpysldwyrkrgieirlaeeaklidrgrkvvitekgevpydtlvlatgararepqikg
keylltlrtifdadrikesiensgeaiiigggfiglelagnlaeagyhvklihrgamflg
ldeelsnmikdmleetgvkfflnselleaneegvltnsgfiegkvkicaigivpnvdlar
rsgihtgrgiliddnfrtsakdvyaigdcaeysgiiagtakaameqarvladilkgeprr
ynfkfrstvfkfgklqiaiigntkgegkwiedntkvfyengkiigavvfndirkatklek
eildfys
Download sequence
Identical sequences 1xhc_A 1xhcA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]