SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1xouA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1xouA
Domain Number 1 Region: 32-189
Classification Level Classification E-value
Superfamily EspA/CesA-like 7.17e-58
Family EspA-like 0.0000000571
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1xouA   PDB: 1xou   SUPERFAMILY: 1xouA
Sequence length 192
Comment (A:)
Sequence
MDTSTTASVASANASTSTSMAYDLGSMSKDDVIDLFNKLGVFQAAILMFAYMYQAQSDLS
IAKFADMNEASKESTTAQKMANLVDAKIADVQSSSDKNAKAQLPDEVISYINDPRNDITI
SGIDNINAQLGAGDLQTVKAAISAKANNLTTTVNNSQLEIQQMSNTLNLLTSARSDMQSL
QYRTISGISLGK
Download sequence
Identical sequences A0A2D0NWQ0 B7UM94 Q47184
1xou_A WP_000381567.1.15869 WP_000381567.1.24909 WP_000381567.1.29341 WP_000381567.1.30550 WP_000381567.1.30691 WP_000381567.1.32587 WP_000381567.1.33352 WP_000381567.1.33584 WP_000381567.1.47488 WP_000381567.1.48902 WP_000381567.1.4892 WP_000381567.1.49342 WP_000381567.1.55936 WP_000381567.1.57202 WP_000381567.1.5787 WP_000381567.1.59425 WP_000381567.1.59793 WP_000381567.1.59900 WP_000381567.1.62262 WP_000381567.1.65122 WP_000381567.1.68279 WP_000381567.1.69735 WP_000381567.1.72066 WP_000381567.1.76643 WP_000381567.1.79749 WP_000381567.1.80016 WP_000381567.1.83036 WP_000381567.1.8386 WP_000381567.1.84021 WP_000381567.1.87990 WP_000381567.1.8807 WP_000381567.1.88147 WP_000381567.1.89455 WP_000381567.1.91954 WP_000381567.1.94686 574521.E2348C_3936 1xouA gi|215488967|ref|YP_002331398.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]