SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1xt0B from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1xt0B
Domain Number 1 Region: 16-194
Classification Level Classification E-value
Superfamily Sec7 domain 1.17e-75
Family Sec7 domain 0.00000372
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1xt0B   PDB: 1xt0   SUPERFAMILY: 1xt0B
Sequence length 203
Comment (B:)
Sequence
gashpeiekaqreiieafnakpknginkikeiceqykispneeiaeffhqqrknldleav
gdylsspeaenqqvlkaftsqmnfngqsfveglrtflktfklpgeaqkidrlvqsfsgay
fqqnpdvvsnadaayllafqtimlntdlhnpsipeknkmtvdglkrnlrggnnggdfdak
fleelyseikakpfelnfvktsp
Download sequence
Identical sequences 1xt0B 1xt0_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]