SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1ydcA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ydcA
Domain Number 1 Region: 4-258
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.91e-143
Family Carbonic anhydrase 0.0000000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ydcA   PDB: 1ydc   SUPERFAMILY: 1ydcA
Sequence length 259
Comment (A:)
Sequence
shhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslriln
nghafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlv
hwntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdpr
gllpesldywtypgsfttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmv
dnwrpaqplknrqikasfk
Download sequence
Identical sequences 1ydcA 1ydb_A 1ydc_A cath|current|1ydbA00/5-260 cath|current|1ydcA00/5-260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]