SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1yqyA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1yqyA
Domain Number 1 Region: 9-293
Classification Level Classification E-value
Superfamily ADP-ribosylation 1e-77
Family ADP-ribosylating toxins 0.000000000119
Further Details:      
 
Domain Number 2 Region: 294-515
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.2e-53
Family Anthrax toxin lethal factor, N- and C-terminal domains 0.00000000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1yqyA   PDB: 1yqy
Sequence length 523
Comment (A:)
Sequence
gskdpgmlsryekwekikqhyqhwsdslseegrgllkklqipiepkkddiihslsqeeke
llkriqidssdflsteekeflkklqidirdslseeekellnriqvdssnplsekekeflk
klkldiqpydinqrlqdtgglidspsinldvrkqykrdiqnidallhqsigstlynkiyl
yenmninnltatlgadlvdstdntkinrgifnefkknfkysissnymivdinerpaldne
rlkwriqlspdtragylengklilqrnigleikdvqiikqsekeyiridakvvpkskidt
kiqeaqlninqewnkalglpkytklitfnvhnryasnivesaylilnewknniqsdlikk
vtnylvdgngrfvftditlpniaeqythqdeiyeqvhskglyvpesrsillhgpskgvel
rndsegfihefghavddyagylldknqsdlvtnskkfidifkeegsnltsygrtneaeff
aeafrlmhstdhaerlkvqknapktfqfindqikfiinslvpr
Download sequence
Identical sequences 1yqy_A 1yqyA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]