SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1ysgA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ysgA
Domain Number 1 Region: 7-160
Classification Level Classification E-value
Superfamily Bcl-2 inhibitors of programmed cell death 3.74e-72
Family Bcl-2 inhibitors of programmed cell death 0.000000555
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ysgA   PDB: 1ysg
Sequence length 181
Comment (A:)
Sequence
msmamsqsnrelvvdflsyklsqkgyswsqfsdveenrteapegteseavkqalreagde
felryrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvd
kemqvlvsriaawmatylndhlepwiqenggwdtfvelygnnaaaesrkgqerlehhhhh
h
Download sequence
Identical sequences 1ysgA 1ysg_A 1ysi_A 1ysn_A 2m03_A 2o1y_A 2yxj_A 2yxj_B 3pl7_A 3pl7_B 3qkd_A 3qkd_B 3zln_A 3zlo_A cath|current|1bxlA00/-3-217 cath|current|1ysgA00/1-221 cath|current|1ysiA00/1-221 cath|current|1ysnA00/1-221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]