SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1zncA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1zncA
Domain Number 1 Region: 17-263
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.1e-107
Family Carbonic anhydrase 0.00000000982
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1zncA   PDB: 1znc   SUPERFAMILY: 1zncA
Sequence length 266
Comment (A:)
Sequence
aeshwcyevqaessnypclvpvkwggncqkdrqspinivttkakvdkklgrfffsgydkk
qtwtvqnnghsvmmllenkasisggglpapyqakqlhlhwsdlpykgsehsldgehfame
mhivhekekgtsrnvkeaqdpedeiavlaflveagtqvnegfqplvealsnipkpemstt
maesslldllpkeeklrhyfrylgslttptcdekvvwtvfrepiqlhreqilafsqklyy
dkeqtvsmkdnvrplqqlgqrtviks
Download sequence
Identical sequences 1znc_A 1znc_B 3f7b_A 3f7b_B 3f7u_A 3f7u_B 3f7u_C 3f7u_D 3fw3_A 3fw3_B 5jn8_A 5jn8_B 5jn8_C 5jn8_D 5jn9_A 5jn9_B 5jn9_C 5jn9_D 5jna_A 5jna_B 5jna_C 5jna_D 5jnc_A 5jnc_B 5jnc_C 5jnc_D 5ku6_A 5ku6_B 5ku6_C 5ku6_D 1zncA 002071052|e5jn8A1|62.1.1.1|A:1-266 002071056|e5jn9A1|62.1.1.1|A:1-266 002071060|e5jnaA1|62.1.1.1|A:1-266 002071064|e5jncA1|62.1.1.1|A:1-266 002095606|e5ku6A1|62.1.1.1|A:1-266 cath|current|1zncA00/5-259 cath|current|1zncB00/5-259 cath|current|3f7bA00/2-259 cath|current|3f7bB00/5-259 cath|current|3f7uA00/5-259 cath|current|3f7uB00/5-259 cath|current|3f7uC00/5-259 cath|current|3f7uD00/5-259 cath|current|3fw3A00/5-259 cath|current|3fw3B00/4-259 d5jn8a_ d5jn9a_ d5jnaa_ d5jnca_ d5ku6a_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]