SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1zvvA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1zvvA
Domain Number 1 Region: 62-331
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.21e-121
Family L-arabinose binding protein-like 0.000027
Further Details:      
 
Domain Number 2 Region: 3-48
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 9.54e-28
Family GalR/LacI-like bacterial regulator 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1zvvA   PDB: 1zvv
Sequence length 332
Comment (A:)
Sequence
mnvtiydvareasvsmatvsrvvngnpnvkpstrkkvletierlgyrpnavarglaskkt
ttvgviipdisnifyaelargiediasmykyniilsnsdqnqdkqlhllnnmlgkqvdgi
ifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkni
afvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedekp
taifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydigav
amrlltkymnketvdssivelphriefrqstk
Download sequence
Identical sequences 1zvv_A 1zvv_B 1zvv_G 2jcg_A 1zvvA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]