SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2aerT from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2aerT
Domain Number 1 Region: 103-205
Classification Level Classification E-value
Superfamily Fibronectin type III 1e-35
Family Fibronectin type III 0.00000231
Further Details:      
 
Domain Number 2 Region: 5-109
Classification Level Classification E-value
Superfamily Fibronectin type III 4.31e-27
Family Fibronectin type III 0.0000454
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2aerT   PDB: 2aer
Sequence length 206
Comment (T:)
Sequence
atvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeiv
kdvkqtylarvfsypagnvestgsageplyenspeftpyletnlgqptiqsfeqvgtkvn
vtvedertlvrrnntflslrdvfgkdliytlyywkssssgkktaktntneflidvdkgen
ycfsvqavipsrtvnrkstdspvecm
Download sequence
Identical sequences 2aer_T 2aerT

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]