SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2axyA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2axyA
Domain Number 1 Region: 6-72
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.21e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2axyA   PDB: 2axy
Sequence length 73
Comment (A:)
Sequence
knvtltirllmhgkevgsiigkkgesvkkmreesgarinisegncperiitlagptnaif
kafamiidkleed
Download sequence
Identical sequences 2axy_A 2axy_B 2axy_C 2axy_D 2pqu_A 2pqu_B 2pqu_C 2pqu_D 2py9_A 2py9_B 2py9_C 2py9_D 2axyA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]