SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2b76A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2b76A
Domain Number 1 Region: 2-250,361-415
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.73e-72
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.000000000679
Further Details:      
 
Domain Number 2 Region: 436-581
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 8.79e-61
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00000016
Further Details:      
 
Domain Number 3 Region: 227-358
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 6.84e-43
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.0000000851
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2b76A   PDB: 2b76
Sequence length 602
Comment (A:)
Sequence
mqtfqadlaivgaggaglraaiaaaqanpnakialiskvypmrshtvaaqggsaavaqdh
dsfeyhfhdtvaggdwlceqdvvdyfvhhcptemtqlelwgcpwsrrpdgsvnvrrfggm
kiertwfaadktgfhmlhtlfqtslqfpqiqrfdehfvldilvddghvrglvamnmmegt
lvqiranavvmatggagrvyryntnggivtgdgmgmalshgvplrdmefvqyhptglpgs
gilmtegcrgeggilvnkngyrylqdygmgpetplgepknkymelgprdkvsqafwhewr
kgntistprgdvvyldlrhlgekklherlpficelakayvgvdpvkepipvrptahytmg
gietdqncetrikglfavgecssvglhganrlgsnslaelvvfgrlageqateraatagn
gneaaieaqaagveqrlkdlvnqdggenwakirdemglameegcgiyrtpelmqktidkl
aelqerfkrvritdtssvfntdllytielghglnvaecmahsamarkesrgahqrldegc
terddvnflkhtlafrdadgttrleysdvkittlppakrvyggeadaadkaeaankkeka
ng
Download sequence
Identical sequences 2b76A 2b76_A 2b76_M

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]