SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2bcgG from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2bcgG
Domain Number 1 Region: 9-300
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.68e-68
Family GDI-like N domain 0.00000000004
Further Details:      
 
Domain Number 2 Region: 307-401
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.27e-41
Family GDI-like 0.00000197
Further Details:      
 
Domain Number 3 Region: 402-447
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000000481
Family GDI-like N domain 0.0000856
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2bcgG   PDB: 2bcg
Sequence length 453
Comment (G:)
Sequence
ghmdqetidtdydvivlgtgitecilsgllsvdgkkvlhidkqdhyggeaasvtlsqlye
kfkqnpiskeereskfgkdrdwnvdlipkflmangeltnilihtdvtryvdfkqvsgsyv
fkqgkiykvpaneieaissplmgifekrrmkkflewissykeddlsthqgldldkntmde
vyykfglgnstkefighamalwtnddylqqparpsferillycqsvarygkspylypmyg
lgelpqgfarlsaiyggtymldtpidevlykkdtgkfegvktklgtfkaplviadptyfp
ekckstgqrviraicilnhpvpntsnadslqiiipqsqlgrksdiyvaivsdahnvcskg
hylaiistiietdkphielepafkllgpieekfmgiaelfepredgskdniylsrsydas
shfesmtddvkdiyfrvtghplvlkqrqeqekq
Download sequence
Identical sequences 1ukv_G 2bcg_G 2bcgG

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]