SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2bi7A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2bi7A
Domain Number 1 Region: 2-265,334-373
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 4.22e-53
Family UDP-galactopyranose mutase, N-terminal domain 0.000000000194
Further Details:      
 
Domain Number 2 Region: 248-316
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.2e-26
Family UDP-galactopyranose mutase 0.00000646
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2bi7A   PDB: 2bi7
Sequence length 384
Comment (A:)
Sequence
mkskkilivgagfsgavigrqlaekghqvhiidqrdhiggnsydardsetnvmvhvygph
ifhtdnetvwnyvnkhaemmpyvnrvkatvngqvfslpinlhtinqffsktcspdearal
iaekgdstiadpqtfeeealrfigkelyeaffkgytikqwgmqpselpasilkrlpvrfn
yddnyfnhkfqgmpkcgytqmiksilnhenikvdlqrefiveerthydhvfysgpldafy
gyqygrlgyrtldfkkftyqgdyqgcavmnycsvdvpytritehkyfspweqhdgsvcyk
eysraceendipyypirqmgemallekylslaenetnitfvgrlgtyryldmdvtiaeal
ktaevylnsltenqpmpvftvsvr
Download sequence
Identical sequences 2bi7_A 2bi8_A 2bi7A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]