SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2bidA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2bidA
Domain Number 1 Region: 2-196
Classification Level Classification E-value
Superfamily Bcl-2 inhibitors of programmed cell death 6.12e-79
Family Bcl-2 inhibitors of programmed cell death 0.00000000676
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2bidA   PDB: 2bid   SUPERFAMILY: 2bidA
Sequence length 197
Comment (A:)
Sequence
gsmdcevnngsslrdecitnllvfgflqscsdnsfrreldalghelpvlapqwegydelq
tdgnrsshsrlgrieadsesqediirniarhlaqvgdsmdrsippglvnglalqlrntsr
seedrnrdlataleqllqayprdmekektmlvlalllakkvashtpsllrdvfhttvnfi
nqnlrtyvrslarngmd
Download sequence
Identical sequences 000003312|e2bidA1|5000.3.1.4|A:1-197 cath|current|2bidA00/1-197 d2bida_ 2bid_A 2bidA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]