SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2bonA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2bonA
Domain Number 1 Region: 46-313
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 8.4e-71
Family Diacylglycerol kinase-like 0.00000000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2bonA   PDB: 2bon
Sequence length 332
Comment (A:)
Sequence
mhhhhhhgstslykkagsetlyiqgmaefpasllilngkstdnlplreaimllreegmti
hvrvtwekgdaaryveearkfgvatviagggdgtinevstaliqcegddipalgilplgt
andfatsvgipealdkalklaiagdaiaidmaqvnkqtcfinmatggfgtrittetpekl
kaalgsvsyiihglmrmdtlqpdrceirgenfhwqgdalvigigngrqagggqqlcpnal
indgllqlriftgdeilpalvstlksdednpniiegasswfdiqaphditfnldgeplsg
qnfhieilpaalrcrlppdcpllrsthhhhhh
Download sequence
Identical sequences 2bon_A 2bon_B 2bonA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]