SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2bs3A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2bs3A
Domain Number 1 Region: 458-654
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 4.32e-59
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00000000298
Further Details:      
 
Domain Number 2 Region: 4-116,145-274,374-433
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.61e-56
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.000000000594
Further Details:      
 
Domain Number 3 Region: 251-370
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 4.61e-37
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.000000219
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2bs3A   PDB: 2bs3
Sequence length 656
Comment (A:)
Sequence
MKVQYCDSLVIGGGLAGLRAAVATQQKGLSTIVLSLIPVKRSHSAAAQGGMQASLGNSKM
SDGDNEDLHFMDTVKGSDWGCDQKVARMFVNTAPKAIRELAAWGVPWTRIHKGDRMAIIN
AQKTTITEEDFRHGLIHSRDFGGTKKWRTCYTADATGHTMLFAVANECLKLGVSIQDRKE
AIALIHQDGKCYGAVVRDLVTGDIIAYVAKGTLIATGGYGRIYKNTTNAVVCEGTGTAIA
LETGIAQLGNMEAVQFHPTPLFPSGILLTEGCRGDGGILRDVDGHRFMPDYEPEKKELAS
RDVVSRRMIEHIRKGKGVQSPYGQHLWLDISILGRKHIETNLRDVQEICEYFAGIDPAEK
WAPVLPMQHYSMGGIRTDYRGEAKLKGLFSAGEAACWDMHGFNRLGGNSVSEAVVAGMIV
GEYFAEHCANTQVDLETKTLEKFVKGQEAYMKSLVESKGTEDVFKIKNRMKDVMDDNVGI
FRDGPHLEKAVKELEELYKKSKNVGIKNKRLHANPELEEAYRVPMMLKVALCVAKGALDR
TESRGAHNREDYPKRDDINWLNRTLASWPNPEQTLPTLEYEALDVNEMEIAPGYRGYGAK
GNYIENPLSVKRQEEIDKIQSELEAAGKDRHAIQEALMPYELPAKYKARNERLGDK
Download sequence
Identical sequences P17412
WP_011138739.1.32730 gi|34557227|ref|NP_907042.1| 273121.WS0831 1e7p_A 1e7p_D 1e7p_G 1e7p_J 2bs3_A 2bs3_D 2bs4_A 2bs4_D 2bs3A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]