SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2c73A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2c73A
Domain Number 1 Region: 1-310,414-454
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.25e-77
Family FAD-linked reductases, N-terminal domain 0.0000000000416
Further Details:      
 
Domain Number 2 Region: 290-400
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.01e-35
Family L-aminoacid/polyamine oxidase 0.000000407
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2c73A   PDB: 2c73
Sequence length 520
Comment (A:)
Sequence
msnkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsy
vgptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwr
tmddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethev
salwflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidq
trenvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivy
ykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeer
lkklcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdr
iyfagtetathwsgfmegaveageraareilhamgkipedeiwqsepesvdvpaqpittt
flerhlpsvpgllrliglttifsatalgflahkrgllvrv
Download sequence
Identical sequences 2c73A 2c73_A 2c73_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]