SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2ctjA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2ctjA
Domain Number 1 Region: 21-89
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.47e-27
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000488
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2ctjA   PDB: 2ctj
Sequence length 95
Comment (A:)
Sequence
gssgssgsiqkdlaniaevevsipaklhnsligtkgrlirsimeecggvhihfpvegsgs
dtvvirgpssdvekakkqllhlaeekqtksgpssg
Download sequence
Identical sequences cath|current|2ctjA00/1-95 2ctjA 2ctj_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]