SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2culA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2culA
Domain Number 1 Region: 4-186
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.76e-26
Family GidA-like 0.00000000534
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2culA   PDB: 2cul
Sequence length 232
Comment (A:)
Sequence
MAAYQVLIVGAGFSGAETAFWLAQKGVRVGLLTQSLDAVMMPFLPPKPPFPPGSLLERAY
DPKDERVWAFHARAKYLLEGLRPLHLFQATATGLLLEGNRVVGVRTWEGPPARGEKVVLA
VGSFLGARLFLGGVVEEAGRLSEASYPDLLEDLSRLGFRFVEREGEVPETPSTPGYRVRY
LAFHPEEWEEKTFRLKRLEGLYAVGLCVREGDYARMSEEGKRLAEHLLHELG
Download sequence
Identical sequences Q5SH33
2culA ttk003001157.1 2cul_A gi|55981866|ref|YP_145163.1| cath|current|2culA00/2-231 WP_011228995.1.52262 YP_145163.1.19876 300852.TTHA1897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]