SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2cyeA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2cyeA
Domain Number 1 Region: 8-129
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 1.6e-46
Family 4HBT-like 0.00000259
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2cyeA   PDB: 2cye
Sequence length 133
Comment (A:)
Sequence
MEGFPVRVRVDVRFRDLDPLGHVNNAVFLSYMELARIRYFQRISPDWLEEGHFVVARMEV
DYLRPILLGDEVFVGVRTVGLGRSSLRMEHLVTANGESAAKGLGVLVWLEGGRPAPLPEA
IRERIRALEGRPL
Download sequence
Identical sequences Q5SH84
300852.TTHA1846 2cye_A 2cye_B 2cye_C 2cye_D 2cyeA WP_011228953.1.52262 YP_145112.1.19876 gi|55981815|ref|YP_145112.1| d2cyec_ ttk003001811.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]