SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2dn7A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2dn7A
Domain Number 1 Region: 8-92
Classification Level Classification E-value
Superfamily Fibronectin type III 3.87e-19
Family Fibronectin type III 0.000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2dn7A   PDB: 2dn7
Sequence length 107
Comment (A:)
Sequence
gssgssgpgrptmmisttamntallqwhppkelpgellgyrlqycradearpntidfgkd
dqhftvtglhkgttyifrlaaknraglgeefekeirtpedlsgpssg
Download sequence
Identical sequences cath|current|2dn7A00/1-107 2dn7A 2dn7_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]