SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2dw4A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2dw4A
Domain Number 1 Region: 105-499,580-585,616-658
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.22e-98
Family FAD-linked reductases, N-terminal domain 0.000000000000599
Further Details:      
 
Domain Number 2 Region: 12-95
Classification Level Classification E-value
Superfamily Homeodomain-like 3.33e-35
Family SWIRM domain 0.00000445
Further Details:      
 
Domain Number 3 Region: 484-592
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.21e-30
Family L-aminoacid/polyamine oxidase 0.00000057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2dw4A   PDB: 2dw4
Sequence length 660
Comment (A:)
Sequence
sgvegaafqsrlphdrmtsqeaacfpdiisgpqqtqkvflfirnrtlqlwldnpkiqltf
eatlqqleapynsdtvlvhrvhsylerhglinfgiykrikplptkktgkviiigsgvsgl
aaarqlqsfgmdvtlleardrvggrvatfrkgnyvadlgamvvtglggnpmavvskqvnm
elakikqkcplyeangqavpkekdemveqefnrlleatsylshqldfnvlnnkpvslgqa
levviqlqekhvkdeqiehwkkivktqeelkellnkmvnlkekikelhqqykeasevkpp
rditaeflvkskhrdltalckeydelaetqgkleeklqeleanppsdvylssrdrqildw
hfanlefanatplstlslkhwdqdddfeftgshltvrngyscvpvalaegldiklntavr
qvrytasgceviavntrstsqtfiykcdavlctlplgvlkqqppavqfvpplpewktsav
qrmgfgnlnkvvlcfdrvfwdpsvnlfghvgsttasrgelflfwnlykapillalvagea
agimenisddvivgrclailkgifgssavpqpketvvsrwradpwargsysyvaagssgn
dydlmaqpitpgpsipgapqpiprlffagehtirnypatvhgallsglreagriadqflg
Download sequence
Identical sequences 2dw4_A 2dw4A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]