SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2f5vA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2f5vA
Domain Number 1 Region: 327-524
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 6.15e-70
Family GMC oxidoreductases 0.00000000177
Further Details:      
 
Domain Number 2 Region: 15-331,520-584
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.02e-46
Family FAD-linked reductases, N-terminal domain 0.0000000000318
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2f5vA   PDB: 2f5v
Sequence length 595
Comment (A:)
Sequence
slpplpgpdkkvpgmdikydvvivgsgpigctyarelvgagykvamfdigeidsglkiga
hkkntveyqknidkfvnviqgqlmsvsvpvntlvvdtlsptswqastffvrngsnpeqdp
lrnlsgqavtrvvggmsthwtcatprfdreqrpllvkddadaddaewdrlytkaesyfqt
gtdqfkesirhnlvlnklaeeykgqrdfqqiplaatrrsptfvewssantvfdlqnrpnt
dapeerfnlfpavacervvrnalnseieslhihdlisgdrfeikadvyvltagavhntql
lvnsgfgqlgrpnptnppellpslgsyiteqslvfcqtvmstelidsvksdmtirgtpge
ltysvtytpgastnkhpdwwnekvknhmmqhqedplpipfedpepqvttlfqpshpwhtq
ihrdafsygavqqsidsrlivdwrffgrtepkeenklwfsdkitdaynmpqptfdfrfpa
grtskeaedmmtdmcvmsakiggflpgslpqfmepglvlhlggthrmgfdekednccvnt
dsrvfgfknlflggcgniptayganptltamslaiksceyikqnftpspftseaq
Download sequence
Identical sequences 2f5vA 2f5v_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]