SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2fr8A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2fr8A
Domain Number 1 Region: 1-186
Classification Level Classification E-value
Superfamily Formate/glycerate dehydrogenase catalytic domain-like 6.66e-52
Family L-alanine dehydrogenase-like 0.000000146
Further Details:      
 
Domain Number 2 Region: 144-325
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.66e-42
Family Formate/glycerate dehydrogenases, NAD-domain 0.0000000283
Further Details:      
 
Domain Number 3 Region: 328-384
Classification Level Classification E-value
Superfamily Formate/glycerate dehydrogenase catalytic domain-like 0.00000124
Family L-alanine dehydrogenase-like 0.0000435
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2fr8A   PDB: 2fr8
Sequence length 384
Comment (A:)
Sequence
mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
amelmpaisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
gvaglqaiatakrlgavvmatdvraatkeqveslggkfitvddeamktaetaggyakemg
eefrkkqaeavlkelvktdiaittalipgkpapvliteemvtkmkpgsviidlaveaggn
cplsepgkivvkhgvkivghtnvpsrvaadasplfaknllnfltphvdkdtktlvmkled
etvsgtcvtrdgaivhpaltgqga
Download sequence
Identical sequences 2fr8A 2fr8_A 2fr8_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]