SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2ftmB from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2ftmB
Domain Number 1 Region: 2-56
Classification Level Classification E-value
Superfamily BPTI-like 9.2e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2ftmB   PDB: 2ftm
Sequence length 58
Comment (B:)
Sequence
rpdfcleppytgpckariiryfynakaglcqtfvgggcrakrnnfksaedcmrtcgga
Download sequence
Identical sequences 2ftmB 000090448|e2ftmB1|384.1.1.13|B:1-58 000090484|e8ptiA1|384.1.1.13|A:1-58 cath|current|2ftmB00/1-58 cath|current|8ptiA00/1-58 d2ftmb_ d8ptia_ 2ftm_B 8pti_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]