SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2gf3A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2gf3A
Domain Number 1 Region: 3-218,321-378
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.73e-50
Family FAD-linked reductases, N-terminal domain 0.000000000411
Further Details:      
 
Domain Number 2 Region: 218-320
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.15e-29
Family D-aminoacid oxidase-like 0.000000665
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2gf3A   PDB: 2gf3
Sequence length 389
Comment (A:)
Sequence
sthfdvivvgagsmgmaagyqlakqgvktllvdafdpphtngshhgdtriirhaygegre
yvplalrsqelwyelekethhkiftktgvlvfgpkgesafvaetmeaakehsltvdlleg
deinkrwpgitvpenynaifepnsgvlfsencirayrelaeargakvlthtrvedfdisp
dsvkietangsytadklivsmgawnskllsklnldiplqpyrqvvgffesdeskysndid
fpgfmvevpngiyygfpsfggcglklgyhtfgqkidpdtinrefgvypedesnlraflee
ympgangelkrgavcmytktldehfiidlhpehsnvviaagfsghgfkfssgvgevlsql
altgktehdisifsinrpalkeslqktti
Download sequence
Identical sequences 2gf3A 1el5_A 1el5_B 1el7_A 1el7_B 1el8_A 1el8_B 1el9_A 1el9_B 1eli_A 1eli_B 1l9e_A 1l9e_B 2a89_A 2a89_B 2gb0_A 2gb0_B 2gf3_A 2gf3_B 3qse_A 3qse_B 3qsm_A 3qsm_B 3qss_A 3qss_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]