SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2gjcA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2gjcA
Domain Number 1 Region: 17-323
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.02e-59
Family Thi4-like 0.0000000000295
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2gjcA   PDB: 2gjc
Sequence length 326
Comment (A:)
Sequence
MSATSTATSTSASQLHLNSTPVTHCLSDIVKKEDWSDFKFAPIRESTVSRAMTSRYFKDL
DKFAVSDVIIVGAGSSGLSAAYVIAKNRPDLKVCIIESSVAPGGGSWLGGQLFSAMVMRK
PAHLFLQELEIPYEDEGDYVVVKHAALFISTVLSKVLQLPNVKLFNATCVEDLVTRPPTE
KGEVTVAGVVTNWTLVTQAHGTQCCMDPNVIELAGYKNDGTRDLSQKHGVILSTTGHDGP
FGAFCAKRIVDIDQNQKLGGMKGLDMNHAEHDVVIHSGAYAGVDNMYFAGMEVAELDGLN
RMGPTFGAMALSGVHAAEQILKHFAA
Download sequence
Identical sequences A0A0L8VQV0 B3LI86 B5VJ88 C7GSX8 E7KCK8 E7Q458 H0GGQ2 N1P438 P32318
YGR144W YGR144W YGR144W 4932.YGR144W YGR144W 2gjcA YGR144W NP_011660.1.97178 SCRT_00876 YGR144W YGR144W YGR144W YGR144W YGR144W YGR144W YGR144W YGR144W YGR144W YGR144W YGR144W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]