SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2gmhA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2gmhA
Domain Number 1 Region: 7-236,335-481
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.94e-64
Family FAD-linked reductases, N-terminal domain 0.0000000000016
Further Details:      
 
Domain Number 2 Region: 237-335
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.07e-37
Family Electron transfer flavoprotein-ubiquinone oxidoreductase-like 0.000000756
Further Details:      
 
Domain Number 3 Region: 483-582
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.34e-28
Family ETF-QO domain-like 0.00000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2gmhA   PDB: 2gmh
Sequence length 584
Comment (A:)
Sequence
sstckvpritthytiyprdqdkrwegvnmerfaeeadvvivgagpaglsaatrlkqlaaq
hekdlrvclvekaahigahtlsgacldprafeelfpdwkekgaplntpvtedrfgiltek
yripvpilpglpmnnhgnyvvrlghlvswmgeqaealgvevypgyaaaeilfhedgsvkg
iatndvgiqkdgapkttferglelhakvtifaegchghlakqlykkfdlrancepqtygi
glkelwvidekkwkpgrvdhtvgwpldrhtyggsflyhlnegepllalgfvvgldyqnpy
lspfrefqrwkhhpsikptleggkriaygaralneggfqsipkltfpgglligcspgfmn
vpkikgthtamksgtlaaesifnqltsenlqsktiglhvteyednlknswvwkelysvrn
irpschgilgvyggmiytgifywifrgmepwtlkhkgsdsdqlkpakdctpieypkpdgq
isfdllssvalsgtnhehdqpahltlkddsvpvnrnlsiydgpeqrfcpagvyefvpleq
gdgfrlqinaqncvhcktcdikdpsqninwvvpeggggpayngm
Download sequence
Identical sequences 2gmh_A 2gmh_B 2gmj_A 2gmj_B 2gmhA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]