SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2gv8A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2gv8A
Domain Number 1 Region: 4-237
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.96e-46
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000000198
Further Details:      
 
Domain Number 2 Region: 269-433
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.55e-16
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000000713
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2gv8A   PDB: 2gv8
Sequence length 447
Comment (A:)
Sequence
MCLPTIRKIAIIGAGPSGLVTAKALLAEKAFDQVTLFERRGSPGGVWNYTSTLSNKLPVP
STNPILTTEPIVGPAALPVYPSPLYRDLQTNTPIELMGYCDQSFKPQTLQFPHRHTIQEY
QRIYAQPLLPFIKLATDVLDIEKKDGSWVVTYKGTKAGSPISKDIFDAVSICNGHYEVPY
IPNIKGLDEYAKAVPGSVLHSSLFREPELFVGESVLVVGGASSANDLVRHLTPVAKHPIY
QSLLGGGDIQNESLQQVPEITKFDPTTREIYLKGGKVLSNIDRVIYCTGYLYSVPFPSLA
KLKSPETKLIDDGSHVHNVYQHIFYIPDPTLAFVGLALHVVPFPTSQAQAAFLARVWSGR
LKLPSKEEQLKWQDELMFSLSGANNMYHSLDYPKDATYINKLHDWCKQATPVLEEEFPSP
YWGEKERSIRENMWSIRAKFFGIEPPK
Download sequence
Identical sequences Q9HFE4
SPBP16F5.08c SPBP16F5_08c.1 2gv8_A 2gv8_B 2gvc_A 2gvc_B 2gvc_D 2gvc_E 2gv8A NP_595782.1.19918 4896.SPBP16F5.08c-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]