SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2h6hB from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2h6hB
Domain Number 1 Region: 19-419
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.79e-136
Family Protein prenyltransferases 0.000000000000272
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2h6hB   PDB: 2h6h
Sequence length 437
Comment (B:)
Sequence
maspssftyycppssspvwseplyslrpeharerlqddsvetvtsieqakveekiqevfs
sykfnhlvprlvlqrekhfhylkrglrqltdayecldasrpwlcywilhslelldepipq
ivatdvcqflelcqspeggfgggpgqyphlaptyaavnalciigteeaydiinrekllqy
lyslkqpdgsflmhvggevdvrsaycaasvasltniitpdlfegtaewiarcqnweggig
gvpgmeahggytfcglaalvilkrerslnlksllqwvtsrqmrfeggfqgrcnklvdgcy
sfwqagllpllhralhaqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdf
yhtcfclsglsiaqhfgsgamlhdvvlgvpenalqpthpvynigpdkviqattyflqkpv
pgfeelkdetsaepatd
Download sequence
Identical sequences cath|current|2h6hB00/515-924 2h6hB 2h6h_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]