SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2hj9A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2hj9A
Domain Number 1 Region: 1-338
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.11e-87
Family L-arabinose binding protein-like 0.0000000000086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2hj9A   PDB: 2hj9
Sequence length 339
Comment (A:)
Sequence
gywgyqefldefpeqrnltnalseavraqpvplskptqrpikisvvypgqqvsdywvrni
asfekrlyklninyqlnqvftrpnadikqqslslmealksksdyliftldttrhrkfveh
vldstntklilqnittpvrewdkhqpflyvgfdhaegsrelatefgkffpkhtyysvlyf
segyisdvrgdtfihqvnrdnnfelqsayytkatkqsgydaakaslakhpdvdfiyacst
dvalgavdalaelgredimingwgggsaeldaiqkgdlditvmrmnddtgiamaeaikwd
ledkpvptvysgdfeivtkadsperiealkkrafrysdn
Download sequence
Identical sequences d2hj9a_ d2hj9b_ 2hj9A 2hj9_A 2hj9_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]