SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2hphA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2hphA
Domain Number 1 Region: 3-308
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.4e-84
Family L-arabinose binding protein-like 0.000000000501
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2hphA   PDB: 2hph
Sequence length 316
Comment (A:)
Sequence
madtrigvtiykyddnfmsvvrkaieqdakaapdvqllmndsqndqskqndqidvllakg
vkalainlvdpaaagtviekargqnvpvvffnkepsrkaldsydkayyvgtdskesgiiq
gdliakhwaanqgwdlnkdgqiqfvllkgepghpdaearttyvikelndkgikteqlqld
tamwdtaqakdkmdawlsgpnankievvianndamamgavealkahnkssipvfgvdalp
ealalvksgalagtvlndannqakatfdlaknladgkgaadgtnwkidnkvvrvpyvgvd
kdnlaefskkhhhhhh
Download sequence
Identical sequences 2hphA 2hph_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]