SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2i0zA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2i0zA
Domain Number 1 Region: 25-218,382-439
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.85e-65
Family HI0933 N-terminal domain-like 0.00000000504
Further Details:      
 
Domain Number 2 Region: 217-385
Classification Level Classification E-value
Superfamily HI0933 insert domain-like 1.39e-46
Family HI0933 insert domain-like 0.0000000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2i0zA   PDB: 2i0z
Sequence length 447
Comment (A:)
Sequence
mhhhhhhssgvdlgtenlyfqsnamhydvivigggpsglmaaigaaeeganvllldkgnk
lgrklaisgggrcnvtnrlpldeivkhipgngrflysafsifnnediitffenlgvklke
edhgrmfpvsnkaqsvvdalltrlkdlgvkirtntpvetieyengqtkavilqtgevlet
nhvviavggksvpqtgstgdgyawaekaghtitelfptevpilsnepfirdrslqglalr
dinlsvlnpkgkaiishkmdmlfthfglsgpaalrcsqfvvkalkkfktntiqmsidalp
eenseqlfqrmlkqmkedpkkgiknvlkgyvperyflfllekneidgseqagqvshekir
alvkdfkeftvnvngtqsiekafvtgggvsvkeinpkemsskftnglyfcgevldihgyt
ggynitsalvtgriagttagenakmqy
Download sequence
Identical sequences 2i0zA 2i0z_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]