SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2ignA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2ignA
Domain Number 1 Region: 355-552
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 6.59e-70
Family GMC oxidoreductases 0.00000000177
Further Details:      
 
Domain Number 2 Region: 43-359,548-612
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.71e-46
Family FAD-linked reductases, N-terminal domain 0.0000000000482
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2ignA   PDB: 2ign
Sequence length 623
Comment (A:)
Sequence
mstsssdpffnfakssfrsaaaqkasasslpplpgpdkkvpgmdikydvvivgsgpigct
yarelvgagykvamfdigeidsglkigahkkntveyqknidkfvnviqgqlmsvsvpvnt
lvvdtlsptswqastffvrngsnpeqdplrnlsgqavtrvvggmstawtcatprfdreqr
pllvkddadaddaewdrlytkaesyfqtgtdqfkesirhnlvlnklteeykgqrdfqqip
laatrrsptfvewssantvfdlqnrpntdapeerfnlfpavacervvrnalnseieslhi
hdlisgdrfeikadvyvltagavhntqllvnsgfgqlgrpnpanppellpslgsyiteqs
lvfcqtvmstelidsvksdmtirgtpgeltysvtytpgastnkhpdwwnekvknhmmqhq
edplpipfedpepqvttlfqpshpwhtqihrdafsygavqqsidsrlivdwrffgrtepk
eenklwfsdkitdaynmpqptfdfrfpagrtskeaedmmtdmcvmsakiggflpgslpqf
mepglvlhlggthrmgfdekednccvntdsrvfgfknlflggcgniptayganptltams
laiksceyikqnftpspftseaq
Download sequence
Identical sequences 2ignA 2ign_A 2ign_B 2ign_C 2ign_D 2ign_E 2ign_F 2ign_G 2ign_H 2igo_A 2igo_B 2igo_C 2igo_D 2igo_E 2igo_F 2igo_G 2igo_H 3lsm_A 3lsm_B 3pl8_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]