SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2iidA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2iidA
Domain Number 1 Region: 32-339,445-480
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.87e-63
Family FAD-linked reductases, N-terminal domain 0.0000000000686
Further Details:      
 
Domain Number 2 Region: 320-430
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.49e-31
Family L-aminoacid/polyamine oxidase 0.000000363
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2iidA   PDB: 2iid
Sequence length 498
Comment (A:)
Sequence
addrnplaecfqendyeefleiarnglkatsnpkhvvivgagmaglsaayvlagaghqvt
vleaserpggrvrtyrneeagwyanlgpmrlpekhrivreyirkfdlrlnefsqendnaw
yfiknirkkvgevkkdpgllkypvkpseagksagqlyeeslgkvveelkrtncsyilnky
dtystkeylikegdlspgavdmigdllnedsgyyvsfieslkhddifayekrfdeivdgm
dklptamyrdiqdkvhfnaqvikiqqndqkvtvvyetlsketpsvtadyvivcttsravr
likfnppllpkkahalrsvhyrsgtkifltcttkfweddgihggksttdlpsrfiyypnh
nftngvgviiaygigddanffqaldfkdcadivfndlslihqlpkkdiqsfcypsviqkw
sldkyamggittftpyqfqhfsdpltasqgriyfageytaqahgwidstiksglraardv
nlasenpsgihlsndnel
Download sequence
Identical sequences 1f8r_A 1f8r_B 1f8r_C 1f8r_D 1f8s_A 1f8s_B 1f8s_C 1f8s_D 1f8s_E 1f8s_F 1f8s_G 1f8s_H 2iid_A 2iid_B 2iid_C 2iid_D 2iidA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]