SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2ivdA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2ivdA
Domain Number 1 Region: 17-330,438-469
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.16e-62
Family FAD-linked reductases, N-terminal domain 0.0000000000464
Further Details:      
 
Domain Number 2 Region: 315-421
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 8.35e-30
Family L-aminoacid/polyamine oxidase 0.000000763
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2ivdA   PDB: 2ivd
Sequence length 478
Comment (A:)
Sequence
mdhhhhhhhhmprttgmnvavvgggisglavahhlrsrgtdavllessarlggavgthal
agylveqgpnsfldrepatralaaalnlegriraadpaakrryvytrgrlrsvpasppaf
lasdilplgarlrvagelfsrrapegvdeslaafgrrhlghratqvlldavqtgiyagdv
eqlsvaatfpmlvkmerehrslilgairaqkaqrqaalpagtapklsgalstfdgglqvl
idalaaslgdaahvgarveglaredggwrliieehgrraelsvaqvvlaapahatakllr
plddalaalvagiayapiavvhlgfdagtlpapdgfgflvpaeeqrrmlgaihasttfpf
raeggrvlyscmvggarqpglveqdedalaalareelkalagvtarpsftrvfrwplgip
qynlghlervaaidaalqrlpglhlignaykgvglndcirnaaqladalvagntshap
Download sequence
Identical sequences 2ivdA 2ivd_A 2ivd_B 2ive_A 2ive_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]