SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2iw5A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2iw5A
Domain Number 1 Region: 106-500,581-586,617-659
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.34e-98
Family FAD-linked reductases, N-terminal domain 0.000000000000599
Further Details:      
 
Domain Number 2 Region: 13-96
Classification Level Classification E-value
Superfamily Homeodomain-like 3.38e-35
Family SWIRM domain 0.00000419
Further Details:      
 
Domain Number 3 Region: 485-593
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.21e-30
Family L-aminoacid/polyamine oxidase 0.00000057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2iw5A   PDB: 2iw5
Sequence length 666
Comment (A:)
Sequence
psgvegaafqsrlphdrmtsqeaacfpdiisgpqqtqkvflfirnrtlqlwldnpkiqlt
featlqqleapynsdtvlvhrvhsylerhglinfgiykrikplptkktgkviiigsgvsg
laaarqlqsfgmdvtlleardrvggrvatfrkgnyvadlgamvvtglggnpmavvskqvn
melakikqkcplyeangqavpkekdemveqefnrlleatsylshqldfnvlnnkpvslgq
alevviqlqekhvkdeqiehwkkivktqeelkellnkmvnlkekikelhqqykeasevkp
prditaeflvkskhrdltalckeydelaetqgkleeklqeleanppsdvylssrdrqild
whfanlefanatplstlslkhwdqdddfeftgshltvrngyscvpvalaegldiklntav
rqvrytasgceviavntrstsqtfiykcdavlctlplgvlkqqppavqfvpplpewktsa
vqrmgfgnlnkvvlcfdrvfwdpsvnlfghvgsttasrgelflfwnlykapillalvage
aagimenisddvivgrclailkgifgssavpqpketvvsrwradpwargsysyvaagssg
ndydlmaqpitpgpsipgapqpiprlffagehtirnypatvhgallsglreagriadqfl
gamytl
Download sequence
Identical sequences 2iw5A 2iw5_A 2uxn_A 2uxx_A 4kum_A 4xbf_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]