SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2ja9A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2ja9A
Domain Number 1 Region: 1-95
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.2e-23
Family Cold shock DNA-binding domain-like 0.000012
Further Details:      
 
Domain Number 2 Region: 91-173
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.46e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000423
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2ja9A   PDB: 2ja9
Sequence length 175
Comment (A:)
Sequence
kryipsvndfvigviigtfsdsykvslqnfsssvslsymafpnaskknrptlqvgdlvya
rvctaekeleaeiecfdsttgrdagfgiledgmiidvnlnfarqllfnndfpllkvlaah
tkfevaiglngkiwvkceelsntlacyrtimeccqkndtaafkdiakrqfkeilt
Download sequence
Identical sequences 2ja9A 2ja9_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]