SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2nacA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2nacA
Domain Number 1 Region: 2-172
Classification Level Classification E-value
Superfamily Formate/glycerate dehydrogenase catalytic domain-like 9.99e-65
Family Formate/glycerate dehydrogenases, substrate-binding domain 0.0000000567
Further Details:      
 
Domain Number 2 Region: 149-335
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 5.83e-52
Family Formate/glycerate dehydrogenases, NAD-domain 0.00000000584
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2nacA   PDB: 2nac
Sequence length 393
Comment (A:)
Sequence
akvlcvlyddpvdgypktyarddlpkidhypggqtlptpkaidftpgqllgsvsgelglr
kylesnghtlvvtsdkdgpdsvferelvdadvvisqpfwpayltperiakaknlklalta
gigsdhvdlqsaidrnvtvaevtycnsisvaehvvmmilslvrnylpshewarkggwnia
dcvshaydleamhvgtvaagriglavlrrlapfdvhlhytdrhrlpesvekelnltwhat
redmypvcdvvtlncplhpetehmindetlklfkrgayivntargklcdrdavaralesg
rlagyagdvwfpqpapkdhpwrtmpyngmtphisgttltaqaryaagtreilecffegrp
irdeylivqggalagtgahsyskgnatggseea
Download sequence
Identical sequences 2nac_A 2nac_B 2nad_A 2nad_B 2nacA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]