SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2o22A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2o22A
Domain Number 1 Region: 7-159
Classification Level Classification E-value
Superfamily Bcl-2 inhibitors of programmed cell death 4.62e-71
Family Bcl-2 inhibitors of programmed cell death 0.000000486
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2o22A   PDB: 2o22
Sequence length 164
Comment (A:)
Sequence
hagrtgydnreivmkyihyklsqrgyewdagddveenrteapegtesevvhltlrqagdd
fsrryrrdfaemssqlhltpftargrfatvveelfrdgvnwgrivaffefggvmcvesvn
remsplvdnialwmteylnrhlhtwiqdnggwdafvelygpsmr
Download sequence
Identical sequences 2o22A cath|current|1yswA00/1-204 d1gjha_ d1yswa_ d2o21a_ d2o22a_ 1ysw_A 2o21_A 2o22_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]