SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2ow8k from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2ow8k
Domain Number 1 Region: 3-99
Classification Level Classification E-value
Superfamily Ribosomal protein S10 1.76e-35
Family Ribosomal protein S10 0.00000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2ow8k   PDB: 2ow8
Sequence length 105
Comment (k:)
Sequence
MPKIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSR
EHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKTVGGGR
Download sequence
Identical sequences A0A1J1EV43 F6DEQ3 H7GHV6 H9ZPK1 P62653 P80375 Q5SHN7
1fjg_J 1hnw_J 1hnx_J 1hnz_J 1hr0_J 1ibk_J 1ibl_J 1ibm_J 1jgo_M 1jgp_M 1jgq_M 1ml5_M 1vvj_QJ 1vvj_XJ 1vy4_AJ 1vy4_CJ 1vy5_AJ 1vy5_CJ 1vy6_AJ 1vy6_CJ 1vy7_AJ 1vy7_CJ 1xmo_J 1xmq_J 1xnq_J 1xnr_J 2f4v_J 2hhh_J 2uu9_J 2uua_J 2uub_J 2uuc_J 2uxb_J 2uxc_J 2uxd_J 2vqe_J 2vqf_J 3oto_J 3t1h_J 3t1y_J 4dr1_J 4dr2_J 4dr3_J 4dr4_J 4dr5_J 4dr6_J 4dr7_J 4duy_J 4duz_J 4dv0_J 4dv1_J 4dv2_J 4dv3_J 4dv4_J 4dv5_J 4dv6_J 4dv7_J 4ji0_J 4ji1_J 4ji2_J 4ji3_J 4ji4_J 4ji5_J 4ji6_J 4ji7_J 4ji8_J 4kvb_J 4l47_QJ 4l47_XJ 4l71_QJ 4l71_XJ 4lel_QJ 4lel_XJ 4lf4_J 4lf5_J 4lf6_J 4lf7_J 4lf8_J 4lf9_J 4lfa_J 4lfb_J 4lfc_J 4lfz_QJ 4lfz_XJ 4lnt_QJ 4lnt_XJ 4lsk_QJ 4lsk_XJ 4lt8_QJ 4lt8_XJ 4nxm_J 4nxn_J 4p6f_QJ 4p6f_XJ 4p70_QJ 4p70_XJ 4tua_QJ 4tua_XJ 4tub_QJ 4tub_XJ 4tuc_QJ 4tuc_XJ 4tud_QJ 4tud_XJ 4tue_QJ 4tue_XJ 4v42_AM 4v4i_k 4v4j_k 4v4p_BM 4v4r_AJ 4v4s_AJ 4v4t_AJ 4v4x_AM 4v4y_AM 4v4z_AM 4v51_AJ 4v51_CJ 4v5a_AJ 4v5a_CJ 4v5c_AJ 4v5c_CJ 4v5d_AJ 4v5d_CJ 4v5e_AJ 4v5e_CJ 4v5f_AJ 4v5f_CJ 4v5g_AJ 4v5g_CJ 4v5j_AJ 4v5j_CJ 4v5k_AJ 4v5k_CJ 4v5l_AJ 4v5m_AJ 4v5n_AJ 4v5p_AJ 4v5p_CJ 4v5q_AJ 4v5q_CJ 4v5r_AJ 4v5r_CJ 4v5s_AJ 4v5s_CJ 4v63_AJ 4v63_CJ 4v67_AJ 4v67_CJ 4v6a_AJ 4v6a_CJ 4v6f_BM 4v6f_CM 4v6g_AM 4v6g_CM 4v7j_Aj 4v7j_Bj 4v7k_Aj 4v7k_Bj 4v7l_AJ 4v7l_CJ 4v7m_AJ 4v7m_CJ 4v7w_AJ 4v7w_CJ 4v7x_AJ 4v7x_CJ 4v7y_AJ 4v7y_CJ 4v7z_AJ 4v7z_CJ 4v87_BM 4v87_CM 4v8b_AM 4v8b_CM 4v8c_CM 4v8c_DM 4v8d_AM 4v8d_CM 4v8e_BM 4v8e_DM 4v8f_BM 4v8f_CM 4v8g_AJ 4v8g_CJ 4v8h_AJ 4v8h_CJ 4v8i_AJ 4v8i_CJ 4v8j_AJ 4v8j_CJ 4v8n_AJ 4v8n_CJ 4v8o_AJ 4v8q_BJ 4v8u_AJ 4v8u_CJ 4v8x_AJ 4v8x_CJ 4v90_AJ 4v95_AJ 4v95_CJ 4v97_AJ 4v97_CJ 4v9a_AM 4v9a_CM 4v9b_AM 4v9b_CM 4v9r_AJ 4v9r_CJ 4v9s_AJ 4v9s_CJ 4w2e_j 4w2f_AJ 4w2f_CJ 4w2g_AJ 4w2g_CJ 4w2h_AJ 4w2h_CJ 4w2i_AJ 4w2i_CJ 4w4g_QJ 4w4g_XJ 4wpo_BJ 4wpo_DJ 4wq1_1A 4wq1_1I 4wqf_BJ 4wqf_DJ 4wqr_1A 4wqr_1I 4wqu_BJ 4wqu_DJ 4wqy_BJ 4wqy_DJ 4wr6_1A 4wr6_1I 4wra_1A 4wra_1I 4wro_1I 4wsd_1A 4wsd_1I 4wsm_1A 4wsm_1I 4wt1_1A 4wt1_1I 4wu1_1A 4wu1_1I 4wzd_1A 4wzd_1I 4wzo_1A 4wzo_1I 4y4o_1j 4y4o_2j 4y4p_1j 4y4p_2j 4ypb_QJ 4ypb_XJ 4yy3_J 4yzv_QJ 4yzv_XJ 4z3s_1j 4z3s_2j 4z8c_1j 4z8c_2j 4zsn_QJ 4zsn_XJ 5br8_J 5czp_QJ 5czp_XJ 5d8b_GC 5d8b_KA 5dfe_QJ 5dfe_XJ 5dox_1j 5dox_2j 5doy_1j 5doy_2j 5e7k_1A 5e7k_1I 5e81_1A 5e81_1I 5el4_1A 5el4_1I 5el5_1A 5el5_1I 5el6_1A 5el6_1I 5el7_1A 5el7_1I 5hau_1j 5hau_2j 5hcp_1j 5hcp_2j 5hcq_1j 5hcq_2j 5hcr_1j 5hcr_2j 5hd1_1j 5hd1_2j 5ib7_1A 5ib7_1I 5ib8_1A 5ib8_1I 5ibb_1A 5ibb_1I 5imq_N 5imr_N 5j30_QJ 5j30_XJ 5j3c_QJ 5j3c_XJ 5j4b_1j 5j4b_2j 5j4c_1j 5j4c_2j 5j4d_SA 5j4d_XC 5j8b_j 5lmn_J 5lmo_J 5lmp_J 5lmq_J 5lmr_J 5lms_J 5lmt_J 5lmu_J 5lmv_J 5ndj_1A 5ndj_1I 5ndk_1A 5ndk_1I 5v8i_1j 5v8i_2j 5vp2_1j 5vp2_2j 5vpo_QJ 5vpo_XJ 5vpp_QJ 5vpp_XJ 5w4k_1j 5w4k_2j 5wis_1j 5wis_2j 5wit_1j 5wit_2j 5zlu_E 6b4v_SA 6b4v_WC 6boh_TA 6boh_YC 6bok_RA 6bok_UC 6c5l_AJ 6c5l_CJ 6cae_1j 6cae_2j 6cfj_1j 6cfj_2j 6cfk_1j 6cfk_2j 6cfl_1j 6cfl_2j 6gsj_1A 6gsj_1I 6gsk_1A 6gsk_1I 6gsl_1A 6gsl_1I gi|46199631|ref|YP_005298.1| 262724.TTC1329 300852.TTHA1693 gi|384431873|ref|YP_005641233.1| cath|current|1fjfJ00/3-100 cath|current|1fjgJ00/3-100 cath|current|1hnwJ00/3-100 cath|current|1hnxJ00/3-100 cath|current|1hnzJ00/3-100 cath|current|1hr0J00/3-100 cath|current|1ibkJ00/3-100 cath|current|1iblJ00/3-100 cath|current|1ibmJ00/3-100 cath|current|1xmoJ00/3-100 cath|current|1xmqJ00/3-100 cath|current|1xnqJ00/3-100 cath|current|1xnrJ00/3-100 cath|current|2f4vJ00/3-100 cath|current|2hhhJ00/3-100 cath|current|2i1ck00/3-100 cath|current|2j00J00/3-101 cath|current|2j02J00/3-101 cath|current|2jl5J00/3-101 cath|current|2jl7J00/3-101 cath|current|2ow8k00/3-100 cath|current|2qnhk00/3-100 cath|current|2uu9J00/3-101 cath|current|2uuaJ00/3-101 cath|current|2uubJ00/3-101 cath|current|2uucJ00/3-101 cath|current|2uxbJ00/3-101 cath|current|2uxcJ00/3-101 cath|current|2uxdJ00/3-101 cath|current|2v46J00/3-101 cath|current|2v48J00/3-101 cath|current|2vqeJ00/3-101 cath|current|2vqfJ00/3-101 cath|current|3d5aJ00/3-100 cath|current|3d5cJ00/3-100 cath|current|3f1eJ00/3-100 cath|current|3f1gJ00/3-100 2ow8k 2qnhk 2uubJ gi|55981662|ref|YP_144959.1| WP_008633424.1.25090 WP_008633424.1.52262 WP_008633424.1.60518 WP_008633424.1.65589 WP_008633424.1.85415 WP_008633424.1.96068 YP_144959.1.19876 gi|386359802|ref|YP_006058047.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]