SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2p9cA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2p9cA
Domain Number 1 Region: 108-295
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 5.88e-58
Family Formate/glycerate dehydrogenases, NAD-domain 0.0000000205
Further Details:      
 
Domain Number 2 Region: 7-138
Classification Level Classification E-value
Superfamily Formate/glycerate dehydrogenase catalytic domain-like 1.31e-48
Family Formate/glycerate dehydrogenases, substrate-binding domain 0.00000156
Further Details:      
 
Domain Number 3 Region: 330-409
Classification Level Classification E-value
Superfamily ACT-like 8.35e-20
Family Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain 0.0000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2p9cA   PDB: 2p9c
Sequence length 410
Comment (A:)
Sequence
makvslekdkikfllvegvhqkaleslraagytniefhkgalddeqlkesirdahfiglr
srthltedvinaaeklvaigafaigtnqvdldaaakrgipvfnapfsntrsvaelvigel
llllrgvpeanakahrgvwnklaagsfeargkklgiigyghigtqlgilaeslgmyvyfy
dienklplgnatqvqhlsdllnmsdvvslhvpenpstknmmgakeislmkpgsllinasr
gtvvdipaladalaskhlagaaidvfptepatnsdpftsplaefdnvlltphiggstqea
qeniglevagklikysdngstlsavnfpevslplhvgrrlmhihenrpgvltalnkifae
qgvniaaqylqtsaqmgyvvidieadedvaekalqamkaipgtirarlly
Download sequence
Identical sequences 2p9cA 2p9c_A 2p9c_B 2p9e_A 2p9e_B 2p9e_C 2p9e_D 2pa3_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]