SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2p9hA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2p9hA
Domain Number 1 Region: 3-265
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.01e-75
Family L-arabinose binding protein-like 0.00000000209
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2p9hA   PDB: 2p9h
Sequence length 269
Comment (A:)
Sequence
lligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrvsg
liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq
iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
drllqlsqgqavkgnqllpvslvkrkttl
Download sequence
Identical sequences d2p9ha_ d2p9hb_ d2pafa1 d2pafb1 2p9h_A 2p9h_B 2paf_A 2paf_B 2p9hA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]